x402 List

x402 Protocol Service Directory

SYNTHORA RPC Network Metadata

Blockchain imported

payment-ready 2026-08-04, probe currently failing

imported from the x402 Bazaar, not submitted by the operator · own this service? claim it · or ask to be removed

Returns chain metadata for five EVM chains (Ethereum, Base, Polygon, Arbitrum, Optimism): chain ID, latest block, gas price and finality, read from public RPC endpoints and returned with an Ed25519 signed receipt. Three free calls per wallet via the X-WALLET header.

Pay from $0.001 per request in USDC on Base, settled onchain via the x402 protocol, no signup, no API key needed.

BASE URL https://rpc-network.hergertsynthora.com ENDPOINTS 1 NETWORK Base ASSET USDC MEMBER SINCE 2026-07-20 MONITORED SINCE 2026-07-20

ASSESSMENT

updated 4h ago

Evidence-backed signals, not a single score. Click any chip for the proof. Measured values stay read-only; unknown is honest.

reliability 89.2%
uptime 24h
0%
uptime 7d
0%
uptime 30d
89.2%
uptime 90d
89.2%
response p95
1530ms
avg response
1157ms
total checks
1,375

Measured on the unpaid 402 handshake, not the paid call. A service can 402 correctly and still fail after payment.

compliance A (14/14), stale (probe failing)

14 of 14 x402 conformance checks pass. Full checklist below.

jump to compliance checklist

price $0.001 (p14 in Blockchain)
price (min)
$0.001
category percentile (min)
p14 in Blockchain
endpoints / prices
1 / 1
model
flat
stability
0%
risk clean

No deterministic risk flag. Risk fires only on an exact blocklist match, or a reserved-brand name with a mismatched verified payTo. Never from low uptime, a high price, or a model guess.

domain age
68d
registrar
IONOS SE
hosting
custom
domain created
2026-06-04

Identity facts, not a risk score.

traction ---

This service shares a payout address and its probe has been failing, so its on-chain volume is suppressed until it responds again. Settlements on a shared address while a member is down are not attributed to it.

CHANGES

5 events, detecting since 2026-07-24

Payout, price, and schema changes detected on this service's x402 wire. A payout rotation at an unchanged price shows up here even when nothing else moves. Full feed at /changes.

changes price changed 9d ago (5 since 2026-07-24)

price changed · 9d ago

POST /service · eip155:8453 · USDC: 1000001000

price changed · 12d ago

POST /service · eip155:8453 · USDC: 5000100000

price changed · 18d ago

POST /service · eip155:8453 · USDC: 30005000

price changed · 18d ago

POST /service · eip155:8453 · USDC: 50003000

price changed · 19d ago

POST /service · eip155:8453 · USDC: 10005000

Amounts are on-wire atomic units in the named asset.

see all changes for this service

WHAT IT DOES

ai-derived

Provides chain metadata including chainId, latest block, gas price and finality across 5 EVM chains with deterministic, Ed25519-signed responses.

category
blockchain-metadata
in
body
auth
api key
blockchainevmmetadatagas-pricefinality

AI-generated summary. The measured data is never altered by it.

ENDPOINTS

Service endpoints with HTTP method, path, description, pricing, and network
METHOD PATH DESCRIPTION PRICE NETWORK ASSET 402 CHANNEL
POST /service Chain metadata: chainId, latest block, gas price and finality across 5 EVM chains. Deterministic, Ed25519-signed. First 3 calls FREE per wallet — send header X-WALLET: 0x<addr>. No charge on upstream failure. $0.001 USDC via x402 on Base. SYNTHORA. $0.001 Base USDC header
1 endpoints

REQUEST / RESPONSE EXAMPLE

An unpaid request to POST /service returns HTTP 402 with the payment terms. Settle onchain via your facilitator, then retry with the X-Payment header.

// request
curl -i -X POST 'https://rpc-network.hergertsynthora.com/service'
// 402 response (captured by monitor) · 1 payload · click to expand
[
  {
    "error": "Payment required",
    "accepts": [
      {
        "asset": "0x833589fCD6eDb6E08f4c7C32D4f71b54bdA02913",
        "extra": {
          "name": "USD Coin",
          "version": "2"
        },
        "payTo": "0x10800a5a5B9d72251566EC651E862A8b4B427dE0",
        "amount": "1000",
        "scheme": "exact",
        "network": "eip155:8453",
        "mimeType": "application/json",
        "resource": "https://rpc-network.hergertsynthora.com/service",
        "description": "Chain metadata: chainId, latest block, gas price and finality across 5 EVM chains. Deterministic, Ed25519-signed. First 3 calls FREE per wallet — send header X-WALLET: 0x<addr>. No charge on upstream failure. $0.001 USDC via x402 on Base. SYNTHORA.",
        "maxAmountRequired": "1000",
        "maxTimeoutSeconds": 300
      }
    ],
    "freeTier": {
      "note": "send header X-WALLET: 0x<your Base address> for a free trial",
      "header": "X-WALLET",
      "callsPerWallet": 3
    },
    "resource": {
      "url": "https://rpc-network.hergertsynthora.com/service",
      "mimeType": "application/json",
      "description": "Chain metadata: chainId, latest block, gas price and finality across 5 EVM chains. Deterministic, Ed25519-signed. First 3 calls FREE per wallet — send header X-WALLET: 0x<addr>. No charge on upstream failure. $0.001 USDC via x402 on Base. SYNTHORA."
    },
    "extensions": {
      "bazaar": {
        "info": {
          "input": {
            "body": {
              "chain": "base"
            },
            "type": "http",
            "method": "POST",
            "bodyType": "json"
          },
          "output": {
            "type": "json",
            "example": {
              "ok": true,
              "niche": "rpc-network",
              "result": {
                "op": "network"
              }
            }
          }
        },
        "schema": {
          "type": "object",
          "$schema": "https://json-schema.org/draft/2020-12/schema",
          "required": [
            "input"
          ],
          "properties": {
            "input": {
              "type": "object",
              "required": [
                "type",
                "method",
                "bodyType",
                "body"
              ],
              "properties": {
                "body": {
                  "type": "object",
                  "required": [],
                  "properties": {
                    "chain": {
                      "type": "string",
                      "description": "chain"
                    }
                  }
                },
                "type": {
                  "type": "string",
                  "const": "http"
                },
                "method": {
                  "enum": [
                    "POST",
                    "PUT",
                    "PATCH"
                  ],
                  "type": "string"
                },
                "bodyType": {
                  "enum": [
                    "json",
                    "form-data",
                    "text"
                  ],
                  "type": "string"
                }
              },
              "additionalProperties": false
            },
            "output": {
              "type": "object",
              "required": [
                "type"
              ],
              "properties": {
                "type": {
                  "type": "string"
                },
                "example": {
                  "ok": {
                    "type": "boolean"
                  },
                  "type": "object",
                  "niche": {
                    "type": "string"
                  }
                }
              }
            }
          }
        }
      }
    },
    "x402Version": 2
  }
]

OVER TIME

All charts use the 90d selector; each series spans only the dates it has data for. Every series is also served as JSON at /api/v1/services/synthora-rpc-network-metadata/price, /scores, /volume and /buyers. On-chain volume and distinct buyers are measured over the service's settlement address and are a conservative undercount (only settlements that reach a measured facilitator are counted). The on-chain series roll up hourly, so the latest day can be up to about an hour behind; distinct buyers are counted per payout address, so a service that settles to more than one address is an upper bound.

UPTIME
07-21 · uptime 78.9% · 2103ms avg07-22 · uptime 88.9% · 1581ms avg07-23 · uptime 55.6% · 2046ms avg07-24 · uptime 85.6% · 2375ms avg07-31 · uptime 93.3% · 677ms avg08-02 · uptime 90.0% · 864ms avg08-04 · uptime 85.3% · 611ms avg08-05 · uptime 0.0%08-06 · uptime 0.0%08-07 · uptime 0.0%08-08 · uptime 0.0%08-09 · uptime 0.0%08-10 · uptime 0.0%08-11 · uptime 0.0%08-12 · uptime 0.0%08-13 · uptime 0.0%07-20 · uptime 100.0% · 1198ms avg07-21 · uptime 78.9% · 2103ms avg07-22 · uptime 88.9% · 1581ms avg07-23 · uptime 55.6% · 2046ms avg07-24 · uptime 85.6% · 2375ms avg07-25 · uptime 96.7% · 869ms avg07-26 · uptime 100.0% · 839ms avg07-27 · uptime 100.0% · 1126ms avg07-28 · uptime 97.8% · 1219ms avg07-29 · uptime 100.0% · 1167ms avg07-30 · uptime 98.9% · 1084ms avg07-31 · uptime 93.3% · 677ms avg08-01 · uptime 100.0% · 675ms avg08-02 · uptime 90.0% · 864ms avg08-03 · uptime 98.9% · 662ms avg08-04 · uptime 85.3% · 611ms avg08-05 · uptime 0.0%08-06 · uptime 0.0%08-07 · uptime 0.0%08-08 · uptime 0.0%08-09 · uptime 0.0%08-10 · uptime 0.0%08-11 · uptime 0.0%08-12 · uptime 0.0%08-13 · uptime 0.0%07-2008-13
90d UPTIME 89.2%
RESPONSE TIME
07-20 · 1198ms avg07-20 · 1198ms avg07-21 · 2103ms avg07-21 · 2103ms avg07-22 · 1581ms avg07-22 · 1581ms avg07-23 · 2046ms avg07-23 · 2046ms avg07-24 · 2375ms avg07-24 · 2375ms avg07-25 · 869ms avg07-25 · 869ms avg07-26 · 839ms avg07-26 · 839ms avg07-27 · 1126ms avg07-27 · 1126ms avg07-28 · 1219ms avg07-28 · 1219ms avg07-29 · 1167ms avg07-29 · 1167ms avg07-30 · 1084ms avg07-30 · 1084ms avg07-31 · 677ms avg07-31 · 677ms avg08-01 · 675ms avg08-01 · 675ms avg08-02 · 864ms avg08-02 · 864ms avg08-03 · 662ms avg08-03 · 662ms avg08-04 · 611ms avg08-04 · 611ms avg08-05 · 0ms avg08-05 · 0ms avg08-06 · 0ms avg08-06 · 0ms avg08-07 · 0ms avg08-07 · 0ms avg08-08 · 0ms avg08-08 · 0ms avg08-09 · 0ms avg08-09 · 0ms avg08-10 · 0ms avg08-10 · 0ms avg08-11 · 0ms avg08-11 · 0ms avg08-12 · 0ms avg08-12 · 0ms avg08-13 · 0ms avg08-13 · 0ms avg07-2008-13
AVG RESP 1157ms
PRICE (captured 402, USD)
07-20 · $0.00107-25 · $0.00507-26 · $0.00508-01 · $0.1008-04 · $0.00108-13 · $0.001$0.00107-2008-13
SUB-SCORES (uptime + x402 compliance)
07-20 compliance: 100% checks07-21 uptime: 82.6% compliance: 100% checks07-22 uptime: 84.5% compliance: 100% checks07-23 uptime: 76.1% compliance: 100% checks07-24 uptime: 77.8% compliance: 100% checks07-25 uptime: 80.7% compliance: 100% checks07-26 uptime: 84.0% compliance: 100% checks07-27 uptime: 86.4% compliance: 100% checks07-28 uptime: 88.0% compliance: 100% checks07-29 uptime: 89.2% compliance: 100% checks07-30 uptime: 90.4% compliance: 100% checks07-31 uptime: 90.6% compliance: 100% checks08-01 uptime: 91.3% compliance: 100% checks08-02 uptime: 91.3% compliance: 100% checks08-03 uptime: 91.7% compliance: 100% checks08-04 uptime: 91.6% compliance: 100% checks08-05 uptime: 91.2% compliance: 100% checks08-06 uptime: 91.0% compliance: 100% checks08-07 uptime: 90.7% compliance: 100% checks08-08 uptime: 90.4% compliance: 100% checks08-09 uptime: 90.2% compliance: 100% checks08-10 uptime: 89.9% compliance: 100% checks08-11 uptime: 89.6% compliance: 100% checks08-12 uptime: 89.4% compliance: 100% checks08-13 uptime: 89.2% compliance: 100% checksuptimecompliance07-2008-13

checklist grew 11->14 on 2026-07-28; a step here is a metric change, not a regression

PILLARS OVER TIME (measured)

Measured site and economics pillars from the assessment history, so the latest value shown elsewhere on this page reads as a point on a trend rather than a permanent state.

VOLUME (on-chain settlement, USD)
This service shares a payout address and its probe has been failing, so its on-chain volume is suppressed until it responds again. Settlements on a shared address while a member is down are not attributed to it.
DISTINCT BUYERS
This service shares a payout address and its probe has been failing, so its distinct on-chain buyers are suppressed until it responds again. Settlements on a shared address while a member is down are not attributed to it.

COMPLIANCE

14/14 checks pass · grade A · stale (probe failing)

last 402 captured 2026-08-04 · last up 2026-08-04

  • 402 payload captured
  • accepts[] array present
  • payTo address recoverable
  • payTo at accepts[0].payTo (conformant shape)
  • payTo is a valid on-chain address
  • atomic price declared
  • atomic price in a sane range
  • asset (token) address declared
  • network resolves to CAIP-2
  • payment scheme declared
  • served over HTTPS
  • declares the current x402 version (2)
  • EIP-712 domain parameters present on every EVM entry
  • x402 v2 envelope delivered in the payment-required header

SITE PILLARS

  • homepage reachable
  • openapi doc
  • pricing page
  • llms.txt
  • robots.txt
  • terms page
recent checks (18) live · click to expand
TIME STATUS RESP CAUSE
○ DOWN 206ms bad_status: unexpected HTTP 404
○ DOWN 187ms bad_status: unexpected HTTP 404
○ DOWN 722ms bad_status: unexpected HTTP 404
○ DOWN 207ms bad_status: unexpected HTTP 404
○ DOWN 209ms bad_status: unexpected HTTP 404
○ DOWN 1146ms bad_status: unexpected HTTP 404
○ DOWN 469ms bad_status: unexpected HTTP 404
○ DOWN 553ms bad_status: unexpected HTTP 404
○ DOWN 595ms bad_status: unexpected HTTP 404
○ DOWN 396ms bad_status: unexpected HTTP 404
○ DOWN 258ms bad_status: unexpected HTTP 404
○ DOWN 1642ms bad_status: unexpected HTTP 404
○ DOWN 300ms bad_status: unexpected HTTP 404
○ DOWN 1033ms bad_status: unexpected HTTP 404
○ DOWN 339ms bad_status: unexpected HTTP 404
○ DOWN 826ms bad_status: unexpected HTTP 404
○ DOWN 427ms bad_status: unexpected HTTP 404
○ DOWN 360ms bad_status: unexpected HTTP 404

EMBED THIS BADGE

Show that SYNTHORA RPC Network Metadata is monitored on x402-list. Paste this on your site or README, it links back to this live listing.

SYNTHORA RPC Network Metadata listed on x402-list
status
SYNTHORA RPC Network Metadata uptime on x402-list
live uptime
// HTML
<a href="https://x402-list.com/services/synthora-rpc-network-metadata?utm_source=badge&utm_medium=referral&utm_campaign=embed">
  <img src="https://x402-list.com/badge/synthora-rpc-network-metadata.svg" alt="SYNTHORA RPC Network Metadata listed on x402-list" height="28">
</a>
// Markdown
[![SYNTHORA RPC Network Metadata on x402-list](https://x402-list.com/badge/synthora-rpc-network-metadata.svg)](https://x402-list.com/services/synthora-rpc-network-metadata?utm_source=badge&utm_medium=referral&utm_campaign=embed)
// HTML · live uptime variant
<a href="https://x402-list.com/services/synthora-rpc-network-metadata?utm_source=badge&utm_medium=referral&utm_campaign=embed">
  <img src="https://x402-list.com/badge/synthora-rpc-network-metadata.svg?data=uptime" alt="SYNTHORA RPC Network Metadata uptime on x402-list" height="28">
</a>

RUN THIS SERVICE?

Keep this listing accurate: propose changes to the name, description, website, category or add new endpoints to monitor. Ownership is verified with a domain proof and every change is reviewed manually; measured data stays read-only.

[ update this listing ]

Earn the verified tier: x402list pays a real call to this endpoint and, if it delivers, the service is delivery-verified. The fee covers the cost of the probe, not the badge; there is no refund if the call does not deliver. Agent and API only, no in-browser signing. See /api.

[ verify this service ($0.25) ]

To request delisting, email info@x402-list.com or update your listing at /services/synthora-rpc-network-metadata/update.